RAB18 (NM_021252) Human Tagged ORF Clone

SKU
RC205505
RAB18 (Myc-DDK-tagged)-Human RAB18, member RAS oncogene family (RAB18)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB18
Synonyms RAB18LI1; WARBM3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205505 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGAGGACGTGCTAACCACCCTGAAGATCCTCATCATCGGCGAGAGTGGGGTGGGCAAGTCCAGCC
TGCTCTTGAGGTTCACAGATGATACGTTTGATCCAGAACTTGCAGCAACAATAGGTGTTGACTTTAAGGT
GAAAACAATTTCAGTGGATGGAAATAAGGCTAAACTTGCAATATGGGATACTGCTGGTCAAGAGAGGTTT
AGAACATTAACTCCCAGCTATTATAGAGGTGCACAGGGTGTTATATTAGTTTATGATGTCACAAGAAGAG
ATACATTTGTTAAACTGGATAATTGGTTAAATGAATTGGAAACATACTGTACAAGAAATGACATAGTAAA
CATGCTAGTTGGAAATAAAATCGATAAGGAAAATCGTGAAGTCGATAGAAATGAAGGCCTGAAATTTGCA
CGAAAGCATTCCATGTTATTTATAGAGGCAAGTGCAAAAACCTGTGATGGTGTACAATGTGCCTTTGAAG
AACTTGTTGAAAAGATCATTCAGACCCCTGGACTGTGGGAAAGTGAGAACCAGAATAAAGGAGTCAAACT
GTCACACAGGGAAGAAGGCCAAGGAGGAGGAGCCTGTGGTGGTTATTGCTCTGTGTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205505 protein sequence
Red=Cloning site Green=Tags(s)

MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERF
RTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFA
RKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021252
ORF Size 618 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021252.5
RefSeq Size 5003 bp
RefSeq ORF 621 bp
Locus ID 22931
UniProt ID Q9NP72
Cytogenetics 10p12.1
Domains ARF, RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
MW 23 kDa
Summary The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies is zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]
Write Your Own Review
You're reviewing:RAB18 (NM_021252) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205505L1 Lenti ORF clone of Human RAB18, member RAS oncogene family (RAB18), Myc-DDK-tagged 10 ug
$600.00
RC205505L2 Lenti ORF clone of Human RAB18, member RAS oncogene family (RAB18), mGFP tagged 10 ug
$600.00
RC205505L3 Lenti ORF clone of Human RAB18, member RAS oncogene family (RAB18), Myc-DDK-tagged 10 ug
$600.00
RC205505L4 Lenti ORF clone of Human RAB18, member RAS oncogene family (RAB18), mGFP tagged 10 ug
$600.00
RG205505 RAB18 (tGFP-tagged) - Human RAB18, member RAS oncogene family (RAB18) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC112945 RAB18 (untagged)-Human RAB18, member RAS oncogene family (RAB18) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.