PHF7 (NM_016483) Human Mass Spec Standard

SKU
PH305192
PHF7 MS Standard C13 and N15-labeled recombinant protein (NP_057567)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205192]
Predicted MW 43.8 kDa
Protein Sequence
Protein Sequence
>RC205192 protein sequence
Red=Cloning site Green=Tags(s)

MKTVKEKKECQRLRKSAKTRRVTQRKPSSGPVCWLCLREPGDPEKLGEFLQKDNISVHYFCLILSSKLPQ
RGQSNRGFHGFLPEDIKKEAARASRKICFVCKKKGAAINCQKDQCLRNFHLPCGQERGCLSQFFGEYKSF
CDKHRPTQNIQHGHVGEESCILCCEDLSQQSVENIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNR
KEFPQEMLRMGIHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHG
THRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPS
LLEKPESSRGRRSYSWRSKGVRITNSCKKSK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057567
RefSeq Size 2240
RefSeq ORF 1143
Synonyms HSPC045; HSPC226; NYD-SP6
Locus ID 51533
UniProt ID Q9BWX1
Cytogenetics 3p21.1
Summary Spermatogenesis is a complex process regulated by extracellular and intracellular factors as well as cellular interactions among interstitial cells of the testis, Sertoli cells, and germ cells. This gene is expressed in the testis in Sertoli cells but not germ cells. The protein encoded by this gene contains plant homeodomain (PHD) finger domains, also known as leukemia associated protein (LAP) domains, believed to be involved in transcriptional regulation. The protein, which localizes to the nucleus of transfected cells, has been implicated in the transcriptional regulation of spermatogenesis. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:PHF7 (NM_016483) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402558 PHF7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406629 PHF7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402558 Transient overexpression lysate of PHD finger protein 7 (PHF7), transcript variant 1 100 ug
$436.00
LY406629 Transient overexpression lysate of PHD finger protein 7 (PHF7), transcript variant 2 100 ug
$436.00
TP305192 Recombinant protein of human PHD finger protein 7 (PHF7), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.