CHAC2 (NM_001008708) Human Mass Spec Standard

SKU
PH305083
CHAC2 MS Standard C13 and N15-labeled recombinant protein (NP_001008708)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205083]
Predicted MW 20.9 kDa
Protein Sequence
Protein Sequence
>RC205083 protein sequence
Red=Cloning site Green=Tags(s)

MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVG
KEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGR
NTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001008708
RefSeq Size 1305
RefSeq ORF 552
Synonyms GCG1
Locus ID 494143
UniProt ID Q8WUX2
Cytogenetics 2p16.2
Summary The protein encoded by this gene is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. It is thought that this gene is upregulated in response to endoplasmic reticulum stress and that the glutathione depletion enhances apoptosis. [provided by RefSeq, Sep 2016]
Write Your Own Review
You're reviewing:CHAC2 (NM_001008708) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC423355 CHAC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423355 Transient overexpression lysate of ChaC, cation transport regulator homolog 2 (E. coli) (CHAC2) 100 ug
$436.00
TP305083 Recombinant protein of human ChaC, cation transport regulator homolog 2 (E. coli) (CHAC2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.