OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CHAC2 (NM_001008708) Human Mass Spec Standard

Be the first to review this product
SKU
PH305083
CHAC2 MS Standard C13 and N15-labeled recombinant protein (NP_001008708)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA336141 Rabbit Polyclonal Anti-CHAC2 Antibody
100 ul
$585.00
LY423355 Transient overexpression lysate of ChaC, cation transport regulator homolog 2 (E. coli) (CHAC2) (as WB positive control) 100 ug
$436.00

Other products for "CHAC2 or NM_001008708"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205083
Predicted MW 20.9 kDa
Protein Sequence
Protein Sequence
>RC205083 protein sequence
Red=Cloning site Green=Tags(s)

MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVG
KEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGR
NTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001008708
RefSeq Size 1305
RefSeq ORF 552
Synonyms GCG1
Locus ID 494143
UniProt ID Q8WUX2
Cytogenetics 2p16.2
Summary The protein encoded by this gene is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. It is thought that this gene is upregulated in response to endoplasmic reticulum stress and that the glutathione depletion enhances apoptosis. provided by RefSeq, Sep 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CHAC2" proteins (3)
SKU Description Size Price
LC423355 Lyophilized CHAC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423355 Transient overexpression lysate of ChaC, cation transport regulator homolog 2 (E. coli) (CHAC2) (as WB positive control) 100 ug
$436.00
TP305083 Recombinant protein of human ChaC, cation transport regulator homolog 2 (E. coli) (CHAC2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products