OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARF4 (NM_001660) Human Mass Spec Standard

Be the first to review this product
SKU
PH304984
ARF4 MS Standard C13 and N15-labeled recombinant protein (NP_001651)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA373637 ARF4 Rabbit polyclonal Antibody
100 ul
$410.00
LY400627 Transient overexpression lysate of ADP-ribosylation factor 4 (ARF4) (as WB positive control) 100 ug
$436.00

Other products for "ARF4 or NM_001660"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204984
Predicted MW 20.5 kDa
Protein Sequence
Protein Sequence
>RC204984 protein sequence
Red=Cloning site Green=Tags(s)

MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG
QDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMT
DKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001651
RefSeq Size 1758
RefSeq ORF 540
Synonyms ARF2
Locus ID 378
UniProt ID P18085
Cytogenetics 3p14.3
Summary This gene is a member of the human ARF gene family whose members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 5 ARF proteins and 11 ARF-like proteins and constitute one family of the RAS superfamily. The ARF proteins are categorized as class I, class II and class III; this gene is a class II member. The members of each class share a common gene organization. The ARF4 gene spans approximately 12kb and contains six exons and five introns. This gene is the most divergent member of the human ARFs. Conflicting map positions at 3p14 or 3p21 have been reported for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARF4" proteins (3)
SKU Description Size Price
LC400627 Lyophilized ARF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400627 Transient overexpression lysate of ADP-ribosylation factor 4 (ARF4) (as WB positive control) 100 ug
$436.00
TP304984 Recombinant protein of human ADP-ribosylation factor 4 (ARF4), 20 µg 20 ug
$867.00

file-alt Citations

Class II ADP-ribosylation factors are required for efficient secretion of dengue viruses
Kudelko, Brault, Kwok et al
J. Biol. Chem. (2012) 287 (1), 767-77 DOI: 10.1074/jbc.M111.270579
Cited by 6
AI Summary: OriGene products contributed to this study by providing Arf4 (NM_001660) and Arf5 (NM_001662) cDNAs, which were used to construct GFP fusion proteins for investigating the role of class II Arf proteins in dengue virus secretion.
Snippet: (Chicago, IL), and anti-Arf5 mAb from Abnova Corp. (Walnut, CA). Constructs. For the construction of GFP fusion proteins, Arf4 (NM_001660) and Arf5 (NM_001662) cDNAs were purchased from OriGene Technologies (Rockville, MD).
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products