ARF4 (NM_001660) Human Tagged ORF Clone

SKU
RC204984
ARF4 (Myc-DDK-tagged)-Human ADP-ribosylation factor 4 (ARF4)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ARF4
Synonyms ARF2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204984 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCTCACTATCTCCTCCCTCTTCTCCCGACTATTTGGCAAGAAGCAGATGCGCATTTTGATGGTTG
GATTGGATGCTGCTGGCAAGACAACCATTCTGTATAAACTGAAGTTAGGGGAGATAGTCACCACCATTCC
TACCATTGGTTTTAATGTGGAAACAGTAGAATATAAGAACATTTGTTTCACAGTATGGGATGTTGGTGGT
CAAGATAGAATTAGGCCTCTCTGGAAGCATTACTTCCAGAATACCCAGGGTCTTATTTTTGTGGTAGATA
GCAACGATCGTGAAAGAATTCAGGAAGTAGCAGATGAGCTGCAGAAAATGCTTCTGGTAGATGAATTGAG
AGATGCAGTGCTGCTACTTTTTGCAAACAAACAGGATTTGCCAAATGCTATGGCCATCAGTGAAATGACA
GATAAACTAGGGCTTCAGTCTCTTCGTAACAGAACATGGTATGTTCAAGCCACTTGTGCAACACAAGGAA
CTGGTCTGTATGAAGGACTTGACTGGCTGTCAAATGAGCTTTCAAAACGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204984 protein sequence
Red=Cloning site Green=Tags(s)

MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG
QDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMT
DKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001660
ORF Size 540 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001660.4
RefSeq Size 1758 bp
RefSeq ORF 543 bp
Locus ID 378
UniProt ID P18085
Cytogenetics 3p14.3
Domains arf, ARF, RAB, SAR
MW 20.5 kDa
Summary This gene is a member of the human ARF gene family whose members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 5 ARF proteins and 11 ARF-like proteins and constitute one family of the RAS superfamily. The ARF proteins are categorized as class I, class II and class III; this gene is a class II member. The members of each class share a common gene organization. The ARF4 gene spans approximately 12kb and contains six exons and five introns. This gene is the most divergent member of the human ARFs. Conflicting map positions at 3p14 or 3p21 have been reported for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ARF4 (NM_001660) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204984L1 Lenti ORF clone of Human ADP-ribosylation factor 4 (ARF4), Myc-DDK-tagged 10 ug
$600.00
RC204984L2 Lenti ORF clone of Human ADP-ribosylation factor 4 (ARF4), mGFP tagged 10 ug
$600.00
RC204984L3 Lenti ORF clone of Human ADP-ribosylation factor 4 (ARF4), Myc-DDK-tagged 10 ug
$600.00
RC204984L4 Lenti ORF clone of Human ADP-ribosylation factor 4 (ARF4), mGFP tagged 10 ug
$600.00
RG204984 ARF4 (tGFP-tagged) - Human ADP-ribosylation factor 4 (ARF4) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC119092 ARF4 (untagged)-Human ADP-ribosylation factor 4 (ARF4) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.