TMIGD2 (NM_144615) Human Mass Spec Standard

SKU
PH304938
TMIGD2 MS Standard C13 and N15-labeled recombinant protein (NP_653216)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204938]
Predicted MW 30.7 kDa
Protein Sequence
Protein Sequence
>RC204938 protein sequence
Red=Cloning site Green=Tags(s)

MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPY
ITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQ
NRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGPPKKSEDCS
GEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVG
EE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653216
RefSeq Size 1282
RefSeq ORF 846
Synonyms CD28H; IGPR-1; IGPR1
Locus ID 126259
UniProt ID Q96BF3
Cytogenetics 19p13.3
Summary Plays a role in cell-cell interaction, cell migration, and angiogenesis. Through interaction with HHLA2, costimulates T-cells in the context of TCR-mediated activation. Enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TMIGD2 (NM_144615) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408250 TMIGD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432814 TMIGD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408250 Transient overexpression lysate of transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 1 100 ug
$436.00
LY432814 Transient overexpression lysate of transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 2 100 ug
$436.00
TP304938 Recombinant protein of human transmembrane and immunoglobulin domain containing 2 (TMIGD2), 20 µg 20 ug
$737.00
TP329814 Purified recombinant protein of Homo sapiens transmembrane and immunoglobulin domain containing 2 (TMIGD2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.