Septin 2 (SEPT2) (NM_004404) Human Mass Spec Standard

SKU
PH304867
SEPT2 MS Standard C13 and N15-labeled recombinant protein (NP_004395)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204867]
Predicted MW 41.5 kDa
Protein Sequence
Protein Sequence
>RC204867 protein sequence
Red=Cloning site Green=Tags(s)

MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVISG
AAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRH
IIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKI
YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML
ITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGG
DGDGGALGHHV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004395
RefSeq Size 3323
RefSeq ORF 1083
Synonyms DIFF6; hNedd5; NEDD-5; NEDD5; Pnutl3; SEPT2
Locus ID 4735
UniProt ID Q15019
Cytogenetics 2q37.3
Summary Filament-forming cytoskeletal GTPase. Forms a filamentous structure with SEPTIN12, SEPTIN6, SEPTIN2 and probably SEPTIN4 at the sperm annulus which is required for the structural integrity and motility of the sperm tail during postmeiotic differentiation (PubMed:25588830). Required for normal organization of the actin cytoskeleton. Plays a role in the biogenesis of polarized columnar-shaped epithelium by maintaining polyglutamylated microtubules, thus facilitating efficient vesicle transport, and by impeding MAP4 binding to tubulin. Required for the progression through mitosis. Forms a scaffold at the midplane of the mitotic splindle required to maintain CENPE localization at kinetochores and consequently chromosome congression. During anaphase, may be required for chromosome segregation and spindle elongation. Plays a role in ciliogenesis and collective cell movements. In cilia, required for the integrity of the diffusion barrier at the base of the primary cilium that prevents diffusion of transmembrane proteins between the cilia and plasma membranes: probably acts by regulating the assembly of the tectonic-like complex (also named B9 complex) by localizing TMEM231 protein. May play a role in the internalization of 2 intracellular microbial pathogens, Listeria monocytogenes and Shigella flexneri.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Septin 2 (SEPT2) (NM_004404) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH311473 SEPT2 MS Standard C13 and N15-labeled recombinant protein (NP_006146) 10 ug
$3,255.00
PH311650 SEPT2 MS Standard C13 and N15-labeled recombinant protein (NP_001008492) 10 ug
$3,255.00
LC416834 42249 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418011 42249 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423437 42249 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423438 42249 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425241 42249 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416834 Transient overexpression lysate of septin 2 (SEPT2), transcript variant 2 100 ug
$436.00
LY418011 Transient overexpression lysate of septin 2 (SEPT2), transcript variant 4 100 ug
$436.00
LY423437 Transient overexpression lysate of septin 2 (SEPT2), transcript variant 1 100 ug
$436.00
LY423438 Transient overexpression lysate of septin 2 (SEPT2), transcript variant 3 100 ug
$436.00
LY425241 Transient overexpression lysate of septin 2 (SEPT2), transcript variant 1 100 ug
$436.00
TP304867 Recombinant protein of human septin 2 (SEPT2), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP311473 Purified recombinant protein of Homo sapiens septin 2 (SEPT2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP311650 Purified recombinant protein of Homo sapiens septin 2 (SEPT2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.