Septin 2 (SEPT2) (NM_004404) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC204867] |
Predicted MW | 41.5 kDa |
Protein Sequence |
Protein Sequence
>RC204867 protein sequence
Red=Cloning site Green=Tags(s) MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVISG AAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRH IIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKI YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML ITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGG DGDGGALGHHV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004395 |
RefSeq Size | 3323 |
RefSeq ORF | 1083 |
Synonyms | DIFF6; hNedd5; NEDD-5; NEDD5; Pnutl3; SEPT2 |
Locus ID | 4735 |
UniProt ID | Q15019 |
Cytogenetics | 2q37.3 |
Summary | Filament-forming cytoskeletal GTPase. Forms a filamentous structure with SEPTIN12, SEPTIN6, SEPTIN2 and probably SEPTIN4 at the sperm annulus which is required for the structural integrity and motility of the sperm tail during postmeiotic differentiation (PubMed:25588830). Required for normal organization of the actin cytoskeleton. Plays a role in the biogenesis of polarized columnar-shaped epithelium by maintaining polyglutamylated microtubules, thus facilitating efficient vesicle transport, and by impeding MAP4 binding to tubulin. Required for the progression through mitosis. Forms a scaffold at the midplane of the mitotic splindle required to maintain CENPE localization at kinetochores and consequently chromosome congression. During anaphase, may be required for chromosome segregation and spindle elongation. Plays a role in ciliogenesis and collective cell movements. In cilia, required for the integrity of the diffusion barrier at the base of the primary cilium that prevents diffusion of transmembrane proteins between the cilia and plasma membranes: probably acts by regulating the assembly of the tectonic-like complex (also named B9 complex) by localizing TMEM231 protein. May play a role in the internalization of 2 intracellular microbial pathogens, Listeria monocytogenes and Shigella flexneri.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH311473 | SEPT2 MS Standard C13 and N15-labeled recombinant protein (NP_006146) | 10 ug |
$3,255.00
|
|
PH311650 | SEPT2 MS Standard C13 and N15-labeled recombinant protein (NP_001008492) | 10 ug |
$3,255.00
|
|
LC416834 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC418011 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423437 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423438 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC425241 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416834 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 2 | 100 ug |
$436.00
|
|
LY418011 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 4 | 100 ug |
$436.00
|
|
LY423437 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 1 | 100 ug |
$436.00
|
|
LY423438 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 3 | 100 ug |
$436.00
|
|
LY425241 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 1 | 100 ug |
$436.00
|
|
TP304867 | Recombinant protein of human septin 2 (SEPT2), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP311473 | Purified recombinant protein of Homo sapiens septin 2 (SEPT2), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP311650 | Purified recombinant protein of Homo sapiens septin 2 (SEPT2), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.