Septin 2 (SEPT2) (NM_004404) Human Tagged ORF Clone

SKU
RC204867
SEPT2 (Myc-DDK-tagged)-Human septin 2 (SEPT2), transcript variant 4
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Septin 2
Synonyms DIFF6; hNedd5; NEDD-5; NEDD5; Pnutl3; SEPT2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204867 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTAAGCAACAGCCAACTCAGTTTATAAATCCAGAAACACCTGGCTATGTTGGATTTGCAAACCTCC
CCAATCAAGTTCACCGAAAATCAGTGAAAAAAGGTTTTGAGTTCACACTGATGGTGGTCGGTGAATCAGG
TCTAGGAAAATCGACTCTCATAAACAGCCTATTCCTAACTGATCTGTACCCAGAAAGAGTCATATCTGGA
GCAGCAGAAAAAATTGAAAGAACTGTCCAGATTGAGGCTTCAACTGTTGAAATTGAAGAGCGAGGGGTCA
AGCTACGCCTGACAGTGGTAGATACCCCTGGCTATGGTGACGCTATCAACTGCAGAGATTGTTTTAAGAC
AATTATCTCCTATATTGATGAGCAATTTGAGAGGTACCTGCATGACGAGAGCGGCTTGAACAGGCGGCAC
ATCATTGATAATAGGGTGCATTGTTGCTTTTACTTTATTTCACCTTTTGGACATGGACTTAAGCCCTTAG
ATGTGGCGTTTATGAAGGCAATACACAACAAGGTGAATATTGTGCCTGTCATTGCAAAAGCTGACACTCT
CACCCTGAAGGAACGGGAGCGGCTGAAGAAAAGGATTCTGGATGAAATTGAAGAACATAACATCAAAATC
TATCACTTACCTGATGCAGAATCAGATGAAGATGAAGATTTTAAAGAGCAGACTAGACTTCTCAAGGCTA
GCATCCCATTCTCTGTGGTTGGATCCAATCAGTTGATTGAAGCCAAAGGAAAGAAGGTCAGAGGCCGCCT
CTACCCCTGGGGTGTTGTGGAAGTGGAGAACCCAGAGCACAATGACTTTCTGAAGCTGAGAACCATGCTC
ATCACCCACATGCAGGATCTCCAGGAGGTGACCCAGGACCTTCATTATGAAAACTTCCGTTCTGAGAGAC
TCAAGAGAGGCGGCAGGAAAGTGGAGAATGAGGACATGAATAAAGACCAGATCTTGCTGGAAAAAGAAGC
TGAGCTCCGCCGCATGCAAGAGATGATTGCAAGGATGCAGGCGCAGATGCAGATGCAGATGCAGGGCGGG
GATGGCGATGGCGGGGCTCTCGGGCACCACGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204867 protein sequence
Red=Cloning site Green=Tags(s)

MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVISG
AAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRH
IIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKI
YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML
ITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGG
DGDGGALGHHV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004404
ORF Size 1083 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004404.5
RefSeq Size 3323 bp
RefSeq ORF 1086 bp
Locus ID 4735
UniProt ID Q15019
Cytogenetics 2q37.3
Domains GTP_CDC
MW 41.5 kDa
Summary Filament-forming cytoskeletal GTPase. Forms a filamentous structure with SEPTIN12, SEPTIN6, SEPTIN2 and probably SEPTIN4 at the sperm annulus which is required for the structural integrity and motility of the sperm tail during postmeiotic differentiation (PubMed:25588830). Required for normal organization of the actin cytoskeleton. Plays a role in the biogenesis of polarized columnar-shaped epithelium by maintaining polyglutamylated microtubules, thus facilitating efficient vesicle transport, and by impeding MAP4 binding to tubulin. Required for the progression through mitosis. Forms a scaffold at the midplane of the mitotic splindle required to maintain CENPE localization at kinetochores and consequently chromosome congression. During anaphase, may be required for chromosome segregation and spindle elongation. Plays a role in ciliogenesis and collective cell movements. In cilia, required for the integrity of the diffusion barrier at the base of the primary cilium that prevents diffusion of transmembrane proteins between the cilia and plasma membranes: probably acts by regulating the assembly of the tectonic-like complex (also named B9 complex) by localizing TMEM231 protein. May play a role in the internalization of 2 intracellular microbial pathogens, Listeria monocytogenes and Shigella flexneri.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Septin 2 (SEPT2) (NM_004404) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204867L1 Lenti ORF clone of Human septin 2 (SEPT2), transcript variant 4, Myc-DDK-tagged 10 ug
$757.00
RC204867L2 Lenti ORF clone of Human septin 2 (SEPT2), transcript variant 4, mGFP tagged 10 ug
$757.00
RC204867L3 Lenti ORF clone of Human septin 2 (SEPT2), transcript variant 4, Myc-DDK-tagged 10 ug
$757.00
RC204867L4 Lenti ORF clone of Human septin 2 (SEPT2), transcript variant 4, mGFP tagged 10 ug
$757.00
RG204867 41519 (tGFP-tagged) - Human septin 2 (SEPT2), transcript variant 4 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC117402 41519 (untagged)-Human septin 2 (SEPT2), transcript variant 4 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.