OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BACE2 (NM_012105) Human Mass Spec Standard

Be the first to review this product
SKU
PH304860
BACE2 MS Standard C13 and N15-labeled recombinant protein (NP_036237)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY415975 Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a (as WB positive control) 100 ug
$436.00

Other products for "BACE2 or NM_012105"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204860
Predicted MW 56.18 kDa
Protein Sequence
Protein Sequence
>RC204860 representing NM_012105
Red=Cloning site Green=Tags(s)

MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGLALALEPALAS
PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRS
KGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSS
LETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILK
LEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSET
PWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD
RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCGAILLVLIVLL
LLPFRCQRRPRDPEVVNDESSLVRHRWK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036237
RefSeq Size 2993
RefSeq ORF 1554
Synonyms AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP
Locus ID 25825
UniProt ID Q9Y5Z0
Cytogenetics 21q22.2-q22.3
Summary This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer's disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2013
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Alzheimer's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BACE2" proteins (7)
SKU Description Size Price
LC408426 Lyophilized BACE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408427 Lyophilized BACE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415975 Lyophilized BACE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408426 Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c (as WB positive control) 100 ug
$665.00
LY408427 Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b (as WB positive control) 100 ug
$436.00
LY415975 Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a (as WB positive control) 100 ug
$436.00
TP304860 Recombinant protein of human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products