BACE2 (NM_012105) Human Mass Spec Standard

SKU
PH304860
BACE2 MS Standard C13 and N15-labeled recombinant protein (NP_036237)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204860]
Predicted MW 56.18 kDa
Protein Sequence
Protein Sequence
>RC204860 representing NM_012105
Red=Cloning site Green=Tags(s)

MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGLALALEPALAS
PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRS
KGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSS
LETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILK
LEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSET
PWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD
RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCGAILLVLIVLL
LLPFRCQRRPRDPEVVNDESSLVRHRWK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036237
RefSeq Size 2993
RefSeq ORF 1554
Synonyms AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP
Locus ID 25825
UniProt ID Q9Y5Z0
Cytogenetics 21q22.2-q22.3
Summary This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer's disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Alzheimer's disease
Write Your Own Review
You're reviewing:BACE2 (NM_012105) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408426 BACE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408427 BACE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415975 BACE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408426 Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c 100 ug
$665.00
LY408427 Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b 100 ug
$436.00
LY415975 Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a 100 ug
$436.00
TP304860 Recombinant protein of human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.