CA12 (NM_001218) Human Mass Spec Standard
CAT#: PH304810
CA12 MS Standard C13 and N15-labeled recombinant protein (NP_001209)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204810 |
Predicted MW | 39.5 kDa |
Protein Sequence |
>RC204810 protein sequence
Red=Cloning site Green=Tags(s) MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDAS LTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHF AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEEL LPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKF DERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMET EAHA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001209 |
RefSeq Size | 4209 |
RefSeq ORF | 1062 |
Synonyms | CA-XII; CAXII; HsT18816; T18816 |
Locus ID | 771 |
UniProt ID | O43570 |
Cytogenetics | 15q22.2 |
Summary | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Three transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2014] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400487 | CA12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404173 | CA12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400487 | Transient overexpression lysate of carbonic anhydrase XII (CA12), transcript variant 1 |
USD 436.00 |
|
LY404173 | Transient overexpression lysate of carbonic anhydrase XII (CA12), transcript variant 2 |
USD 436.00 |
|
TP304810 | Recombinant protein of human carbonic anhydrase XII (CA12), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review