OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CA12 (NM_001218) Human Mass Spec Standard

Be the first to review this product
SKU
PH304810
CA12 MS Standard C13 and N15-labeled recombinant protein (NP_001209)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505571 CA12 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6) 100 ul
$447.00
LY400487 Transient overexpression lysate of carbonic anhydrase XII (CA12), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CA12 or NM_001218"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204810
Predicted MW 39.5 kDa
Protein Sequence
Protein Sequence
>RC204810 protein sequence
Red=Cloning site Green=Tags(s)

MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDAS
LTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHF
AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEEL
LPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKF
DERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMET
EAHA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001209
RefSeq Size 4209
RefSeq ORF 1062
Synonyms CA-XII; CAXII; HsT18816; T18816
Locus ID 771
UniProt ID O43570
Cytogenetics 15q22.2
Summary Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Three transcript variants encoding different isoforms have been identified for this gene. provided by RefSeq, Jun 2014
Protein Families Druggable Genome, Transmembrane
Protein Pathways Nitrogen metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CA12" proteins (5)
SKU Description Size Price
LC400487 Lyophilized CA12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404173 Lyophilized CA12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400487 Transient overexpression lysate of carbonic anhydrase XII (CA12), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404173 Transient overexpression lysate of carbonic anhydrase XII (CA12), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP304810 Recombinant protein of human carbonic anhydrase XII (CA12), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products