UBE2E2 (NM_152653) Human Mass Spec Standard

SKU
PH304787
UBE2E2 MS Standard C13 and N15-labeled recombinant protein (NP_689866)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204787]
Predicted MW 22.3 kDa
Protein Sequence
Protein Sequence
>RC204787 protein sequence
Red=Cloning site Green=Tags(s)

MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLD
PPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICL
DILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689866
RefSeq Size 1760
RefSeq ORF 603
Synonyms UBCH8
Locus ID 7325
UniProt ID Q96LR5
Cytogenetics 3p24.3
Summary Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Catalyzes the ISGylation of influenza A virus NS1 protein.[UniProtKB/Swiss-Prot Function]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:UBE2E2 (NM_152653) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407379 UBE2E2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407379 Transient overexpression lysate of ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast) (UBE2E2) 100 ug
$436.00
TP304787 Recombinant protein of human ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast) (UBE2E2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.