EXOSC8 (NM_181503) Human Mass Spec Standard

SKU
PH304768
EXOSC8 MS Standard C13 and N15-labeled recombinant protein (NP_852480)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204768]
Predicted MW 30 kDa
Protein Sequence
Protein Sequence
>RC204768 protein sequence
Red=Cloning site Green=Tags(s)

MAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPS
TDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLI
CLDYDGNILDACTFALLAALKNVQLPEVTINEETALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDP
TGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_852480
RefSeq Size 1427
RefSeq ORF 828
Synonyms bA421P11.3; CIP3; EAP2; OIP2; p9; PCH1C; RRP43; Rrp43p
Locus ID 11340
UniProt ID Q96B26
Cytogenetics 13q13.3
Summary This gene encodes a 3'-5' exoribonuclease that specifically interacts with mRNAs containing AU-rich elements. The encoded protein is part of the exosome complex that is important for the degradation of numerous RNA species. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Mar 2009]
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
Write Your Own Review
You're reviewing:EXOSC8 (NM_181503) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405688 EXOSC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405688 Transient overexpression lysate of exosome component 8 (EXOSC8) 100 ug
$436.00
TP304768 Recombinant protein of human exosome component 8 (EXOSC8), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.