EXOSC8 (NM_181503) Human Tagged ORF Clone

SKU
RC204768
EXOSC8 (Myc-DDK-tagged)-Human exosome component 8 (EXOSC8)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EXOSC8
Synonyms bA421P11.3; CIP3; EAP2; OIP2; p9; PCH1C; RRP43; Rrp43p
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204768 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTGGGTTCAAAACCGTGGAACCTCTGGAGTATTACAGGAGATTTCTGAAAGAGAACTGCCGTC
CTGATGGAAGAGAACTTGGTGAATTCAGAACCACAACTGTCAACATCGGTTCAATTAGTACCGCAGATGG
TTCTGCTTTAGTGAAGTTGGGAAATACTACAGTAATCTGTGGAGTTAAAGCAGAATTTGCAGCACCATCA
ACAGATGCCCCTGATAAAGGATACGTTGTTCCTAATGTGGATCTACCACCCCTGTGTTCATCGAGATTCC
GGTCTGGACCTCCTGGAGAAGAGGCCCAAGTGGCTAGCCAATTCATTGCAGATGTCATTGAAAATTCACA
GATAATTCAGAAAGAGGACTTATGCATTTCTCCAGGAAAGCTTGTCTGGGTTCTATACTGTGATCTCATT
TGCCTCGACTACGATGGAAACATTTTGGATGCCTGCACATTTGCTTTGCTAGCGGCTTTAAAAAATGTAC
AGTTGCCTGAAGTTACTATAAATGAAGAAACTGCTTTAGCAGAAGTTAATTTAAAGAAGAAAAGTTATTT
GAATATTAGAACTCATCCAGTTGCAACTTCCTTTGCTGTGTTTGATGACACTTTGCTTATAGTTGACCCT
ACTGGAGAGGAGGAACATCTGGCAACAGGAACCTTAACAATAGTAATGGATGAGGAAGGCAAACTCTGTT
GTCTTCACAAACCAGGTGGAAGTGGGCTAACTGGAGCTAAACTTCAGGACTGTATGAGCCGAGCAGTTAC
AAGACACAAAGAAGTTAAAAAACTGATGGATGAAGTAATTAAGAGTATGAAACCCAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204768 protein sequence
Red=Cloning site Green=Tags(s)

MAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPS
TDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLI
CLDYDGNILDACTFALLAALKNVQLPEVTINEETALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDP
TGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181503
ORF Size 828 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181503.1, NP_852480.1
RefSeq Size 1427 bp
RefSeq ORF 831 bp
Locus ID 11340
UniProt ID Q96B26
Cytogenetics 13q13.3
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
MW 30 kDa
Summary This gene encodes a 3'-5' exoribonuclease that specifically interacts with mRNAs containing AU-rich elements. The encoded protein is part of the exosome complex that is important for the degradation of numerous RNA species. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Mar 2009]
Write Your Own Review
You're reviewing:EXOSC8 (NM_181503) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204768L1 Lenti ORF clone of Human exosome component 8 (EXOSC8), Myc-DDK-tagged 10 ug
$600.00
RC204768L2 Lenti ORF clone of Human exosome component 8 (EXOSC8), mGFP tagged 10 ug
$600.00
RC204768L3 Lenti ORF clone of Human exosome component 8 (EXOSC8), Myc-DDK-tagged 10 ug
$600.00
RC204768L4 Lenti ORF clone of Human exosome component 8 (EXOSC8), mGFP tagged 10 ug
$600.00
RG204768 EXOSC8 (tGFP-tagged) - Human exosome component 8 (EXOSC8) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC307288 EXOSC8 (untagged)-Human exosome component 8 (EXOSC8) 10 ug
$330.00
SC321121 EXOSC8 (untagged)-Human exosome component 8 (EXOSC8) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.