CLIC2 (NM_001289) Human Mass Spec Standard

SKU PH304727

CLIC2 MS Standard C13 and N15-labeled recombinant protein (NP_001280)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC204727]
• Predicted MW: 28.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC204727 protein sequence; Red=Cloning site Green=Tags(s); ; MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP; PFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLL; KEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFS; GVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001280
• RefSeq Size: 2694
• RefSeq ORF: 741
• Synonyms: CLCNL2; CLIC2b; MRXS32; XAP121
• Locus ID: 1193
• UniProt ID: O15247
• Cytogenetics: Xq28
• Summary: This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability. [provided by RefSeq, Jul 2017]
• Protein Families: Druggable Genome, Ion Channels: Other