OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SH2D1A (NM_002351) Human Mass Spec Standard

Be the first to review this product
SKU
PH304723
SH2D1A MS Standard C13 and N15-labeled recombinant protein (NP_002342)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA326947 Rabbit anti-SH2D1A Polyclonal Antibody
100 ul
$410.00
LY400845 Transient overexpression lysate of SH2 domain protein 1A (SH2D1A), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SH2D1A or NM_002351"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204723
Predicted MW 14.2 kDa
Protein Sequence
Protein Sequence
>RC204723 protein sequence
Red=Cloning site Green=Tags(s)

MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAP
GVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002342
RefSeq Size 2523
RefSeq ORF 384
Synonyms DSHP; EBVS; IMD5; LYP; MTCP1; SAP; SAP/SH2D1A; XLP; XLPD; XLPD1
Locus ID 4068
UniProt ID O60880
Cytogenetics Xq25
Summary This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Natural killer cell mediated cytotoxicity
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SH2D1A" proteins (4)
SKU Description Size Price
LC400845 Lyophilized SH2D1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400845 Transient overexpression lysate of SH2 domain protein 1A (SH2D1A), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP304723 Recombinant protein of human SH2 domain protein 1A (SH2D1A), transcript variant 1, 20 µg 20 ug
$867.00
TP720893 Purified recombinant protein of Human SH2 domain containing 1A (SH2D1A), transcript variant 1 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products