SH2D1A (NM_002351) Human Mass Spec Standard

SKU
PH304723
SH2D1A MS Standard C13 and N15-labeled recombinant protein (NP_002342)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204723]
Predicted MW 14.2 kDa
Protein Sequence
Protein Sequence
>RC204723 protein sequence
Red=Cloning site Green=Tags(s)

MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAP
GVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002342
RefSeq Size 2523
RefSeq ORF 384
Synonyms DSHP; EBVS; IMD5; LYP; MTCP1; SAP; SAP/SH2D1A; XLP; XLPD; XLPD1
Locus ID 4068
UniProt ID O60880
Cytogenetics Xq25
Summary This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Natural killer cell mediated cytotoxicity
Write Your Own Review
You're reviewing:SH2D1A (NM_002351) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400845 SH2D1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400845 Transient overexpression lysate of SH2 domain protein 1A (SH2D1A), transcript variant 1 100 ug
$436.00
TP304723 Recombinant protein of human SH2 domain protein 1A (SH2D1A), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720893 Purified recombinant protein of Human SH2 domain containing 1A (SH2D1A), transcript variant 1 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.