MEK6 (MAP2K6) (NM_002758) Human Mass Spec Standard

SKU
PH304481
MAP2K6 MS Standard C13 and N15-labeled recombinant protein (NP_002749)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204481]
Predicted MW 37.5 kDa
Protein Sequence
Protein Sequence
>RC204481 protein sequence
Red=Cloning site Green=Tags(s)

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKM
RHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFY
KQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAK
TIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA
DKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002749
RefSeq Size 1879
RefSeq ORF 1002
Synonyms MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3
Locus ID 5608
UniProt ID P52564
Cytogenetics 17q24.3
Summary This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Amyotrophic lateral sclerosis (ALS), Fc epsilon RI signaling pathway, GnRH signaling pathway, MAPK signaling pathway, Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:MEK6 (MAP2K6) (NM_002758) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400975 MAP2K6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400975 Transient overexpression lysate of mitogen-activated protein kinase kinase 6 (MAP2K6) 100 ug
$436.00
TP304481 Recombinant protein of human mitogen-activated protein kinase kinase 6 (MAP2K6), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.