BLBP (FABP7) (NM_001446) Human Mass Spec Standard

SKU PH304449

FABP7 MS Standard C13 and N15-labeled recombinant protein (NP_001437)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC204449]
• Predicted MW: 14.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC204449 protein sequence; Red=Cloning site Green=Tags(s); ; MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEE; FDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001437
• RefSeq Size: 1005
• RefSeq ORF: 396
• Synonyms: B-FABP; BLBP; FABPB; MRG
• Locus ID: 2173
• UniProt ID: O15540
• Cytogenetics: 6q22.31
• Summary: The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Jan 2016]
• Protein Pathways: PPAR signaling pathway