OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDK2AP1 (NM_004642) Human Mass Spec Standard

Be the first to review this product
SKU
PH304442
CDK2AP1 MS Standard C13 and N15-labeled recombinant protein (NP_004633)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA590189 Rabbit Polyclonal CDK2AP1 Antibody
100 ug
$482.00
LY401472 Transient overexpression lysate of cyclin-dependent kinase 2 associated protein 1 (CDK2AP1) (as WB positive control) 100 ug
$436.00

Other products for "CDK2AP1 or NM_004642"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204442
Predicted MW 12.4 kDa
Protein Sequence
Protein Sequence
>RC204442 protein sequence
Red=Cloning site Green=Tags(s)

MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAII
EELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004633
RefSeq Size 1655
RefSeq ORF 345
Synonyms doc-1; DOC1; DORC1; p12DOC-1; ST19
Locus ID 8099
UniProt ID O14519
Cytogenetics 12q24.31
Summary The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. provided by RefSeq, Jul 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDK2AP1" proteins (3)
SKU Description Size Price
LC401472 Lyophilized CDK2AP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401472 Transient overexpression lysate of cyclin-dependent kinase 2 associated protein 1 (CDK2AP1) (as WB positive control) 100 ug
$436.00
TP304442 Recombinant protein of human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products