AK3 (NM_016282) Human Mass Spec Standard

SKU
PH304408
AK3 MS Standard C13 and N15-labeled recombinant protein (NP_057366)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204408]
Predicted MW 25.6 kDa
Protein Sequence
Protein Sequence
>RC204408 protein sequence
Red=Cloning site Green=Tags(s)

MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDV
MTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNI
EFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYA
FLQTKVPQRSQKASVTP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057366
RefSeq Size 4333
RefSeq ORF 681
Synonyms AK3L1; AK6; AKL3L; AKL3L1; FIX
Locus ID 50808
UniProt ID Q9UIJ7
Cytogenetics 9p24.1
Summary The protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Dec 2010]
Protein Families Druggable Genome
Protein Pathways Pyrimidine metabolism
Write Your Own Review
You're reviewing:AK3 (NM_016282) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414079 AK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414079 Transient overexpression lysate of adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP304408 Recombinant protein of human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.