SLC2A6 (NM_017585) Human Mass Spec Standard

SKU
PH304391
SLC2A6 MS Standard C13 and N15-labeled recombinant protein (NP_060055)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204391]
Predicted MW 54.5 kDa
Protein Sequence
Protein Sequence
>RC204391 protein sequence
Red=Cloning site Green=Tags(s)

MQEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTSPVIPALERSL
DPDLHLTKSQASWFGSVFTLGAAAGGLSAMILNDLLGRKLSIMFSAVPSAAGYALMAGAHGLWMLLLGRT
LTGFAGGLTAACIPVYVSEIAPPGVRGALGATPQLMAVFGSLSLYALGLLLPWRWLAVAGEAPVLIMILL
LSFMPNSPRFLLSRGRDEEALRALAWLRGTDVDVHWEFEQIQDNVRRQSSRVSWAEARAPHVCRPITVAL
LMRLLQQLTGITPILVYLQSIFDSTAVLLPPKDDAAIVGAVRLLSVLIAALTMDLAGRKVLLFVSAAIMF
AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLLATMLFIMGYAVGWGPITWLL
MSEVLPLRARGVASGLCVLASWLTAFVLTKSFLPVVSTFGLQVPFFFFAAICLVSLVFTGCCVPETKGRS
LEQIESFFRTGRRSFLR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060055
RefSeq Size 2563
RefSeq ORF 1521
Synonyms GLUT6; GLUT9; HSA011372
Locus ID 11182
UniProt ID Q9UGQ3
Cytogenetics 9q34.2
Summary Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, that contain 12 transmembrane domains and a number of critical conserved residues.[supplied by OMIM, Jul 2002]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SLC2A6 (NM_017585) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402605 SLC2A6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402605 Transient overexpression lysate of solute carrier family 2 (facilitated glucose transporter), member 6 (SLC2A6), transcript variant 1 100 ug
$436.00
TP304391 Recombinant protein of human solute carrier family 2 (facilitated glucose transporter), member 6 (SLC2A6), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.