CCDC134 (NM_024821) Human Mass Spec Standard

SKU
PH304377
CCDC134 MS Standard C13 and N15-labeled recombinant protein (NP_079097)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204377]
Predicted MW 26.6 kDa
Protein Sequence
Protein Sequence
>RC204377 protein sequence
Red=Cloning site Green=Tags(s)

MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVML
KGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLI
RWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKE
EKRKEIRKGPRISRSQSEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079097
RefSeq Size 1279
RefSeq ORF 687
Locus ID 79879
UniProt ID Q9H6E4
Cytogenetics 22q13.2
Summary In extracellular secreted form, promotes proliferation and activation of CD8(+) T cells, suggesting a cytokine-like function (PubMed:25125657). Enhances cytotoxic anti-tumor activity of CD8(+) T cells (PubMed:25125657). May inhibit ERK and JNK signaling activity (PubMed:18087676, PubMed:23070808). May suppress cell migration and invasion activity, via its effects on ERK and JNK signaling (PubMed:23070808).[UniProtKB/Swiss-Prot Function]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:CCDC134 (NM_024821) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411042 CCDC134 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411042 Transient overexpression lysate of coiled-coil domain containing 134 (CCDC134) 100 ug
$436.00
TP304377 Recombinant protein of human coiled-coil domain containing 134 (CCDC134), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721226 Purified recombinant protein of Human coiled-coil domain containing 134 (CCDC134) 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.