CCDC134 (NM_024821) Human Tagged ORF Clone

SKU
RC204377
CCDC134 (Myc-DDK-tagged)-Human coiled-coil domain containing 134 (CCDC134)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CCDC134
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204377 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCTTCTTCAATTCCTGGCCTTCCTCTTTGTCCTGCTTTTGTCTGGGATGGGAGCCACAGGCACCT
TGAGGACCTCCCTGGACCCAAGCCTGGAGATCTACAAGAAGATGTTTGAGGTGAAGCGGCGGGAGCAGCT
GTTGGCACTGAAGAACCTGGCACAGCTGAACGACATCCACCAGCAGTACAAGATCCTTGATGTCATGCTC
AAGGGGCTCTTTAAGGTGCTGGAGGACTCCCGGACAGTGCTCACCGCTGCTGATGTGCTCCCAGATGGGC
CCTTCCCCCAGGACGAGAAGCTGAAGGATGCTTTCTCCCACGTGGTGGAGAACACGGCCTTCTTCGGCGA
TGTGGTGCTGCGCTTCCCGAGGATTGTGCACTATTACTTTGACCACAACTCCAACTGGAACCTCCTCATC
CGCTGGGGTATCAGTTTCTGCAACCAGACAGGCGTCTTCAACCAGGGGCCCCACTCGCCCATCCTCAGCC
TGATGGCCCAGGAGCTGGGGATCAGTGAGAAAGACTCCAACTTCCAGAACCCATTTAAAATCGACCGCAC
AGAGTTCATTCCCAGCACTGACCCTTTCCAGAAGGCCCTGAGAGAAGAAGAGAAACGCCGAAAGAAAGAG
GAGAAGCGGAAGGAGATCCGAAAAGGCCCAAGGATCTCCAGATCCCAGTCTGAGTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204377 protein sequence
Red=Cloning site Green=Tags(s)

MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVML
KGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLI
RWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKE
EKRKEIRKGPRISRSQSEL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024821
ORF Size 687 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024821.5
RefSeq Size 1279 bp
RefSeq ORF 690 bp
Locus ID 79879
UniProt ID Q9H6E4
Cytogenetics 22q13.2
Protein Families Secreted Protein
MW 26.6 kDa
Summary In extracellular secreted form, promotes proliferation and activation of CD8(+) T cells, suggesting a cytokine-like function (PubMed:25125657). Enhances cytotoxic anti-tumor activity of CD8(+) T cells (PubMed:25125657). May inhibit ERK and JNK signaling activity (PubMed:18087676, PubMed:23070808). May suppress cell migration and invasion activity, via its effects on ERK and JNK signaling (PubMed:23070808).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CCDC134 (NM_024821) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204377L3 Lenti ORF clone of Human coiled-coil domain containing 134 (CCDC134), Myc-DDK-tagged 10 ug
$600.00
RC204377L4 Lenti ORF clone of Human coiled-coil domain containing 134 (CCDC134), mGFP tagged 10 ug
$600.00
RG204377 CCDC134 (tGFP-tagged) - Human coiled-coil domain containing 134 (CCDC134) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC122973 CCDC134 (untagged)-Human coiled-coil domain containing 134 (CCDC134) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.