NUDT18 (NM_024815) Human Mass Spec Standard

SKU
PH304376
NUDT18 MS Standard C13 and N15-labeled recombinant protein (NP_079091)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204376]
Predicted MW 35.3 kDa
Protein Sequence
Protein Sequence
>RC204376 representing NM_024815
Red=Cloning site Green=Tags(s)

MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVFLSEQDEVLLIQEAKRECRGS
WYLPAGRMEPGETIVEALQREVKEEAGLHCEPETLLSVEERGPSWVRFVFLARPTGGILKTSKEADAESL
QAAWYPRTSLPTPLRAHDILHLVELAAQYRQQARHPLILPQELPCDLVCQRLVATFTSAQTVWVLVGTVG
MPHLPVTACGLDPMEQRGGMKMAVLRLLQECLTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRS
PGIQDEPPKVRGENFSWWKVMEEDLQSQLLQRLQGSSVVPVNR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079091
RefSeq Size 1519
RefSeq ORF 969
Synonyms MTH3
Locus ID 79873
UniProt ID Q6ZVK8
Cytogenetics 8p21.3
Summary The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. This protein contains a Nudix hydrolase domain and hydrolyzes oxidized forms of guanosine and deoxyguanosine diphosphates. [provided by RefSeq, Sep 2012]
Write Your Own Review
You're reviewing:NUDT18 (NM_024815) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403033 NUDT18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403033 Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 18 (NUDT18) 100 ug
$436.00
TP304376 Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 18 (NUDT18), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.