Tcl1 (TCL1A) (NM_021966) Human Mass Spec Standard

SKU
PH304243
TCL1A MS Standard C13 and N15-labeled recombinant protein (NP_068801)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204243]
Predicted MW 13.5 kDa
Protein Sequence
Protein Sequence
>RC204243 protein sequence
Red=Cloning site Green=Tags(s)

MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPS
LLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068801
RefSeq Size 1410
RefSeq ORF 342
Synonyms TCL1
Locus ID 8115
UniProt ID P56279
Cytogenetics 14q32.13
Summary Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM 186930) regulatory elements (summarized by Virgilio et al., 1998 [PubMed 9520462]). In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT (MIM 164730) (Laine et al., 2000 [PubMed 10983986]).[supplied by OMIM, Jul 2010]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Tcl1 (TCL1A) (NM_021966) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH313051 TCL1A MS Standard C13 and N15-labeled recombinant protein (NP_001092195) 10 ug
$3,255.00
LC411851 TCL1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420669 TCL1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426041 TCL1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411851 Transient overexpression lysate of T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1 100 ug
$436.00
LY420669 Transient overexpression lysate of T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 2 100 ug
$436.00
TP304243 Recombinant protein of human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP313051 Recombinant protein of human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.