Tcl1 (TCL1A) (NM_021966) Human Tagged ORF Clone
SKU
RC204243
TCL1A (Myc-DDK-tagged)-Human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | Tcl1 |
Synonyms | TCL1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC204243 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCGAGTGCCCGACACTCGGGGAGGCAGTCACCGACCACCCGGACCGCCTGTGGGCCTGGGAGAAGT TCGTGTATTTGGACGAGAAGCAGCACGCCTGGCTGCCCTTAACCATCGAGATAAAGGATAGGTTACAGTT ACGGGTGCTCTTGCGTCGGGAAGACGTCGTCCTGGGGAGGCCTATGACCCCCACCCAGATAGGCCCAAGC CTGCTGCCTATCATGTGGCAGCTCTACCCTGATGGACGATACCGATCCTCAGACTCCAGTTTCTGGCGCT TAGTGTACCACATCAAGATTGACGGCGTGGAGGACATGCTTCTCGAGCTGCTGCCAGATGAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204243 protein sequence
Red=Cloning site Green=Tags(s) MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPS LLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_021966 |
ORF Size | 342 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_021966.3 |
RefSeq Size | 1410 bp |
RefSeq ORF | 345 bp |
Locus ID | 8115 |
UniProt ID | P56279 |
Cytogenetics | 14q32.13 |
Protein Families | Druggable Genome |
MW | 13.5 kDa |
Summary | Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM 186930) regulatory elements (summarized by Virgilio et al., 1998 [PubMed 9520462]). In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT (MIM 164730) (Laine et al., 2000 [PubMed 10983986]).[supplied by OMIM, Jul 2010] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC204243L1 | Lenti ORF clone of Human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC204243L2 | Lenti ORF clone of Human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1, mGFP tagged | 10 ug |
$450.00
|
|
RC204243L3 | Lenti ORF clone of Human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC204243L4 | Lenti ORF clone of Human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1, mGFP tagged | 10 ug |
$450.00
|
|
RG204243 | TCL1A (tGFP-tagged) - Human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1 | 10 ug |
$489.00
|
|
SC112834 | TCL1A (untagged)-Human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1 | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.