Dysbindin (DTNBP1) (NM_032122) Human Mass Spec Standard

SKU
PH304208
DTNBP1 MS Standard C13 and N15-labeled recombinant protein (NP_115498)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204208]
Predicted MW 39.5 kDa
Protein Sequence
Protein Sequence
>RC204208 protein sequence
Red=Cloning site Green=Tags(s)

MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCA
SAGELVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCG
QCELERCKHMQSQQLENYKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQY
LSTGYLQIAERREPIGSMSSMEVNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPALGPESSTCQNE
ITLQVPNPSELRAKPPSSSSTCTDSATRDISEGGESPVVQSDEEEVQVDTALATSHTDREATPDGGEDSD
S

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115498
RefSeq Size 1429
RefSeq ORF 1053
Synonyms BLOC1S8; DBND; HPS7; My031; SDY
Locus ID 84062
UniProt ID Q96EV8
Cytogenetics 6p22.3
Summary This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Dysbindin (DTNBP1) (NM_032122) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403167 DTNBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405212 DTNBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403167 Transient overexpression lysate of dystrobrevin binding protein 1 (DTNBP1), transcript variant 1 100 ug
$436.00
LY405212 Transient overexpression lysate of dystrobrevin binding protein 1 (DTNBP1), transcript variant 2 100 ug
$436.00
TP304208 Recombinant protein of human dystrobrevin binding protein 1 (DTNBP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323289 Recombinant protein of human dystrobrevin binding protein 1 (DTNBP1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761501 Purified recombinant protein of Human dystrobrevin binding protein 1 (DTNBP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.