OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Claudin 2 (CLDN2) (NM_020384) Human Mass Spec Standard

Be the first to review this product
SKU
PH304199
CLDN2 MS Standard C13 and N15-labeled recombinant protein (NP_065117)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350681 Rabbit Polyclonal Anti-CLDN2 Antibody
100 ul
$205.00
LY402780 Transient overexpression lysate of claudin 2 (CLDN2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Claudin 2 or NM_020384"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204199
Predicted MW 24.5 kDa
Protein Sequence
Protein Sequence
>RC204199 protein sequence
Red=Cloning site Green=Tags(s)

MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTL
LGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNL
HGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPR
PGQPPKVKSEFNSYSLTGYV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065117
RefSeq Size 2998
RefSeq ORF 690
Synonyms OAZON
Locus ID 9075
UniProt ID P57739
Cytogenetics Xq22.3
Summary This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region have been found for this gene.provided by RefSeq, Jan 2010
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Claudin 2" proteins (5)
SKU Description Size Price
LC402780 Lyophilized CLDN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432728 Lyophilized CLDN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402780 Transient overexpression lysate of claudin 2 (CLDN2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY432728 Transient overexpression lysate of claudin 2 (CLDN2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP304199 Recombinant protein of human claudin 2 (CLDN2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products