SNAP45 (SNAPC2) (NM_003083) Human Mass Spec Standard

SKU
PH304157
SNAPC2 MS Standard C13 and N15-labeled recombinant protein (NP_003074)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204157]
Predicted MW 35.6 kDa
Protein Sequence
Protein Sequence
>RC204157 protein sequence
Red=Cloning site Green=Tags(s)

MKPPPRRRAAPARYLGEVTGPATWSAREKRQLVRLLQARQGQPEPDATELARELRGRSEAEIRVFLQQLK
GRVAREAIQKVHPGGLQGPRRREAQPPAPIEVWTDLAEKITGPLEEALAVAFSQVLTIAATEPVTLLHSK
PPKPTQARGKPLLLSAPGGQEDPAPEIPSSAPAAPSSAPRTPDPAPEKPSESSAGPSTEEDFAVDFEKIY
KYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPLLPCTALVEHMTETYLRLTAPQPIPAGGSLGPAAE
GDGAGSKAPEETPPATEKAEHSELKSPWQAAGICPLNPFLVPLELLGRAATPAR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003074
RefSeq Size 1561
RefSeq ORF 1002
Synonyms PTFDELTA; SNAP45
Locus ID 6618
UniProt ID Q13487
Cytogenetics 19p13.2
Summary This gene encodes a subunit of the snRNA-activating protein complex which is associated with the TATA box-binding protein. The encoded protein is necessary for RNA polymerase II and III dependent small-nuclear RNA gene transcription. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2009]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:SNAP45 (SNAPC2) (NM_003083) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418914 SNAPC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418914 Transient overexpression lysate of small nuclear RNA activating complex, polypeptide 2, 45kDa (SNAPC2), transcript variant 1 100 ug
$436.00
TP304157 Recombinant protein of human small nuclear RNA activating complex, polypeptide 2, 45kDa (SNAPC2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.