SNAP45 (SNAPC2) Rabbit Polyclonal Antibody

SKU TA330156

Rabbit Polyclonal Anti-SNAPC2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SNAPC2 antibody: synthetic peptide directed towards the middle region of human SNAPC2. Synthetic peptide located within the following region: STEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: small nuclear RNA activating complex polypeptide 2
• Database Link:
  NP_003074
  Q13487
• Background: SNAPC2 is a component of the snRNA activating protein complex (SNAPc). SNAPC2 is exceptionally proline-rich, interacts strongly with TBP, and, other SNAPC components, is required for both RNA polymerase II and III transcription of snRNA genes.
• Synonyms: PTFDELTA; SNAP45
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors