TAF10 (NM_006284) Human Mass Spec Standard

SKU
PH304138
TAF10 MS Standard C13 and N15-labeled recombinant protein (NP_006275)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204138]
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC204138 protein sequence
Red=Cloning site Green=Tags(s)

MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGE
PAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLN
RAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGIN
VKKPHYFT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006275
RefSeq Size 834
RefSeq ORF 654
Synonyms TAF2A; TAF2H; TAFII30
Locus ID 6881
UniProt ID Q12962
Cytogenetics 11p15.4
Summary Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the small subunits of TFIID that is associated with a subset of TFIID complexes. Studies with human and mammalian cells have shown that this subunit is required for transcriptional activation by the estrogen receptor, for progression through the cell cycle, and may also be required for certain cellular differentiation programs. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Basal transcription factors
Write Your Own Review
You're reviewing:TAF10 (NM_006284) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416752 TAF10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416752 Transient overexpression lysate of TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10) 100 ug
$436.00
TP304138 Recombinant protein of human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.