TAF10 (NM_006284) Human Tagged ORF Clone
SKU
RC204138
TAF10 (Myc-DDK-tagged)-Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | TAF10 |
Synonyms | TAF2A; TAF2H; TAFII30 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC204138 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGCTGCAGCGGCTCCGGCGCGGACCCCGAGGCGGCGCCGGCCTCCGCCGCCTCGGCCCCGGGCCCCG CGCCCCCGGTCTCGGCTCCCGCCGCGCTGCCCTCCAGCACCGCCGCGGAGAACAAGGCCAGCCCCGCGGG GACAGCGGGGGGACCTGGGGCTGGAGCAGCTGCTGGGGGCACGGGACCCTTGGCGGCGCGGGCCGGGGAG CCAGCTGAGCGGCGTGGGGCGGCTCCGGTGTCGGCGGGTGGCGCGGCGCCCCCGGAGGGGGCCATATCTA ACGGGGTTTACGTACTGCCGAGCGCGGCCAACGGAGACGTGAAGCCCGTGGTGTCCAGCACGCCTTTGGT GGACTTCTTGATGCAGCTGGAAGATTACACGCCTACGATCCCAGATGCAGTGACTGGTTACTACCTGAAC CGTGCTGGCTTTGAGGCCTCAGACCCACGCATAATTCGGCTCATCTCCTTAGCTGCCCAGAAATTCATCT CAGATATTGCCAATGATGCCCTACAGCACTGCAAAATGAAGGGCACGGCCTCCGGCAGCTCCCGGAGCAA GAGCAAGGACCGCAAGTACACTCTAACCATGGAGGACTTGACCCCTGCCCTCAGCGAGTATGGCATCAAT GTGAAGAAGCCGCACTACTTCACC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204138 protein sequence
Red=Cloning site Green=Tags(s) MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGE PAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLN RAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGIN VKKPHYFT TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_006284 |
ORF Size | 654 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_006284.4 |
RefSeq Size | 834 bp |
RefSeq ORF | 657 bp |
Locus ID | 6881 |
UniProt ID | Q12962 |
Cytogenetics | 11p15.4 |
Domains | TFIID_30kD |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Basal transcription factors |
MW | 21.7 kDa |
Summary | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the small subunits of TFIID that is associated with a subset of TFIID complexes. Studies with human and mammalian cells have shown that this subunit is required for transcriptional activation by the estrogen receptor, for progression through the cell cycle, and may also be required for certain cellular differentiation programs. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC204138L3 | Lenti ORF clone of Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10), Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC204138L4 | Lenti ORF clone of Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10), mGFP tagged | 10 ug |
$600.00
|
|
RG204138 | TAF10 (tGFP-tagged) - Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10) | 10 ug |
$500.00
|
|
SC116191 | TAF10 (untagged)-Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10) | 10 ug |
$300.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.