HIPPI (IFT57) (NM_018010) Human Mass Spec Standard

SKU
PH304116
IFT57 MS Standard C13 and N15-labeled recombinant protein (NP_060480)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204116]
Predicted MW 49.1 kDa
Protein Sequence
Protein Sequence
>RC204116 protein sequence
Red=Cloning site Green=Tags(s)

MTAALAVVTTSGLEDGVPRSRGEGTGEVVLERGPGAAYHMFVVMEDLVEKLKLLRYEEEFLRKSNLKAPS
RHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGY
GEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNKVDEEFVEEETDNEENFIDLNV
LKAQTYHLDMNETAKQEDILESTTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHRSGIESALK
ETKGFLDKLHNEITRTLEKISSREKYINNQLENLVQEYRAAQAQLSEAKERYQQGNGGVTERTRLLSEVM
EELEKVKQEMEEKGSSMTDGAPLVKIKQSLTKLKQETVEMDIRIGIVEHTLLQSKLKEKSNMTRNMHATV
IPEPATGFY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060480
RefSeq Size 3223
RefSeq ORF 1287
Synonyms ESRRBL1; HIPPI; MHS4R2; OFD18
Locus ID 55081
UniProt ID Q9NWB7
Cytogenetics 3q13.12-q13.13
Summary Required for the formation of cilia. Plays an indirect role in sonic hedgehog signaling, cilia being required for all activity of the hedgehog pathway (By similarity). Has pro-apoptotic function via its interaction with HIP1, leading to recruit caspase-8 (CASP8) and trigger apoptosis. Has the ability to bind DNA sequence motif 5'-AAAGACATG-3' present in the promoter of caspase genes such as CASP1, CASP8 and CASP10, suggesting that it may act as a transcription regulator; however the relevance of such function remains unclear.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Protein Pathways Huntington's disease
Write Your Own Review
You're reviewing:HIPPI (IFT57) (NM_018010) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402637 IFT57 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402637 Transient overexpression lysate of intraflagellar transport 57 homolog (Chlamydomonas) (IFT57) 100 ug
$436.00
TP304116 Recombinant protein of human intraflagellar transport 57 homolog (Chlamydomonas) (IFT57), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.