POLR3K (NM_016310) Human Mass Spec Standard

SKU PH304102

POLR3K MS Standard C13 and N15-labeled recombinant protein (NP_057394)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC204102]
• Predicted MW: 12.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC204102 protein sequence; Red=Cloning site Green=Tags(s); ; MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCP; KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057394
• RefSeq Size: 834
• RefSeq ORF: 324
• Synonyms: C11; C11-RNP3; HLD21; My010; RPC10; RPC11; RPC12.5
• Locus ID: 51728
• UniProt ID: Q9Y2Y1
• Cytogenetics: 16p13.3
• Summary: This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17.[provided by RefSeq, Jul 2010]
• Protein Families: Transcription Factors
• Protein Pathways: Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase