POLR3K (NM_016310) Human Tagged ORF Clone

SKU
RC204102
POLR3K (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol POLR3K
Synonyms C11; C11-RNP3; HLD21; My010; RPC10; RPC11; RPC12.5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204102 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTGTTCTGCCCCGGCTGCGGGAACGGGCTGATCGTGGAGGAGGGACAACGCTGCCACCGCTTCG
CCTGCAACACGTGCCCCTACGTGCACAACATCACCCGCAAGGTAACAAATCGGAAGTACCCAAAACTGAA
AGAAGTGGATGATGTGCTTGGTGGAGCAGCTGCCTGGGAGAATGTTGACTCTACTGCAGAGTCGTGTCCC
AAATGCGAACATCCTCGTGCTTACTTCATGCAGCTTCAGACCCGCTCTGCAGATGAGCCGATGACCACCT
TCTACAAGTGCTGCAATGCTCAGTGTGGACACCGCTGGAGGGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204102 protein sequence
Red=Cloning site Green=Tags(s)

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCP
KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016310
ORF Size 324 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016310.5
RefSeq Size 834 bp
RefSeq ORF 327 bp
Locus ID 51728
UniProt ID Q9Y2Y1
Cytogenetics 16p13.3
Domains RNA_POL_M_15KD, TFIIS
Protein Families Transcription Factors
Protein Pathways Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
MW 12.3 kDa
Summary This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17.[provided by RefSeq, Jul 2010]
Write Your Own Review
You're reviewing:POLR3K (NM_016310) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204102L3 Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K), Myc-DDK-tagged 10 ug
$450.00
RC204102L4 Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K), mGFP tagged 10 ug
$450.00
RG204102 POLR3K (tGFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K) 10 ug
$489.00
SC114310 POLR3K (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.