PGAM1 (NM_002629) Human Mass Spec Standard

SKU
PH304054
PGAM1 MS Standard C13 and N15-labeled recombinant protein (NP_002620)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204054]
Predicted MW 28.8 kDa
Protein Sequence
Protein Sequence
>RC204054 protein sequence
Red=Cloning site Green=Tags(s)

MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTV
LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR
RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNL
PTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002620
RefSeq Size 1762
RefSeq ORF 762
Synonyms HEL-S-35; PGAM-B; PGAMA
Locus ID 5223
UniProt ID P18669
Cytogenetics 10q24.1
Summary The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Protein Pathways Glycolysis / Gluconeogenesis, Metabolic pathways
Write Your Own Review
You're reviewing:PGAM1 (NM_002629) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400934 PGAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400934 Transient overexpression lysate of phosphoglycerate mutase 1 (brain) (PGAM1) 100 ug
$436.00
TP304054 Recombinant protein of human phosphoglycerate mutase 1 (brain) (PGAM1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.