OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BORCS5 (NM_058169) Human Mass Spec Standard

Be the first to review this product
SKU
PH303844
LOH12CR1 MS Standard C13 and N15-labeled recombinant protein (NP_477517)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA507004 LOH12CR1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1) 100 ul
$447.00
LY409223 Transient overexpression lysate of loss of heterozygosity, 12, chromosomal region 1 (LOH12CR1) (as WB positive control) 100 ug
$436.00

Other products for "BORCS5 or NM_058169"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203844
Predicted MW 22.2 kDa
Protein Sequence
Protein Sequence
>RC203844 protein sequence
Red=Cloning site Green=Tags(s)

MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLL
SGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYA
KYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_477517
RefSeq Size 2092
RefSeq ORF 588
Synonyms LOH1CR12; LOH12CR1
Locus ID 118426
UniProt ID Q969J3
Cytogenetics 12p13.2
Summary As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. Thereby, it may indirectly play a role in cell spreading and motility.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BORCS5" proteins (3)
SKU Description Size Price
LC409223 Lyophilized LOH12CR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409223 Transient overexpression lysate of loss of heterozygosity, 12, chromosomal region 1 (LOH12CR1) (as WB positive control) 100 ug
$436.00
TP303844 Recombinant protein of human loss of heterozygosity, 12, chromosomal region 1 (LOH12CR1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products