BORCS5 (NM_058169) Human Tagged ORF Clone

SKU
RC203844
LOH12CR1 (Myc-DDK-tagged)-Human loss of heterozygosity, 12, chromosomal region 1 (LOH12CR1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BORCS5
Synonyms LOH1CR12; LOH12CR1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203844 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAGTGAGCAGAGCTCCGAGGCCGAGAGCCGACCCAACGATCTGAACTCCTCAGTGACTCCTTCAC
CAGCCAAGCATAGAGCCAAGATGGATGATATTGTGGTTGTAGCTCAGGGCTCCCAGGCCTCACGGAACGT
CAGCAACGATCCCGATGTCATCAAGTTGCAAGAGATTCCAACCTTCCAGCCCCTTTTGAAAGGGCTATTG
AGTGGCCAGACTTCCCCAACAAATGCCAAATTGGAGAAACTGGACTCTCAGCAGGTGTTGCAGCTCTGCC
TCCGATATCAAGATCACCTGCATCAGTGTGCAGAGGCCGTTGCTTTTGACCAGAATGCTTTGGTTAAACG
AATCAAAGAGATGGATCTGTCTGTAGAAACTCTGTTCAGCTTCATGCAGGAGCGCCAGAAAAGATACGCC
AAGTATGCCGAGCAGATCCAGAAAGTGAACGAGATGTCCGCCATCCTCCGCCGCATACAGATGGGCATCG
ACCAGACTGTGCCCCTGCTGGACAGGCTCAACAGCATGCTGCCCGAGGGCGAGCGGCTGGAGCCCTTCAG
CATGAAGCCCGACCGCGAGCTCAGGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203844 protein sequence
Red=Cloning site Green=Tags(s)

MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLL
SGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYA
KYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_058169
ORF Size 588 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_058169.6
RefSeq Size 2092 bp
RefSeq ORF 591 bp
Locus ID 118426
UniProt ID Q969J3
Cytogenetics 12p13.2
MW 22.2 kDa
Summary As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. Thereby, it may indirectly play a role in cell spreading and motility.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:BORCS5 (NM_058169) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203844L3 Lenti ORF clone of Human loss of heterozygosity, 12, chromosomal region 1 (LOH12CR1), Myc-DDK-tagged 10 ug
$600.00
RC203844L4 Lenti ORF clone of Human loss of heterozygosity, 12, chromosomal region 1 (LOH12CR1), mGFP tagged 10 ug
$600.00
RG203844 LOH12CR1 (tGFP-tagged) - Human loss of heterozygosity, 12, chromosomal region 1 (LOH12CR1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC120239 LOH12CR1 (untagged)-Human loss of heterozygosity, 12, chromosomal region 1 (LOH12CR1) 10 ug
$300.00
SC324648 LOH12CR1 (untagged)-Human loss of heterozygosity, 12, chromosomal region 1 (LOH12CR1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.