PSMG3 (NM_032302) Human Mass Spec Standard

SKU
PH303835
PSMG3 MS Standard C13 and N15-labeled recombinant protein (NP_115678)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203835]
Predicted MW 13.1 kDa
Protein Sequence
Protein Sequence
>RC203835 protein sequence
Red=Cloning site Green=Tags(s)

MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQ
DEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115678
RefSeq Size 1395
RefSeq ORF 366
Synonyms C7orf48; PAC3
Locus ID 84262
UniProt ID Q9BT73
Cytogenetics 7p22.3
Summary Chaperone protein which promotes assembly of the 20S proteasome. May cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PSMG3 (NM_032302) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410244 PSMG3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427395 PSMG3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410244 Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1 100 ug
$436.00
LY427395 Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 2 100 ug
$436.00
TP303835 Recombinant protein of human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760843 Purified recombinant protein of Human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.