SIAH2 (NM_005067) Human Mass Spec Standard

SKU
PH303802
SIAH2 MS Standard C13 and N15-labeled recombinant protein (NP_005058)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203802]
Predicted MW 34.4 kDa
Protein Sequence
Protein Sequence
>RC203802 representing NM_005067
Red=Cloning site Green=Tags(s)

MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQ
HHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKY
ATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDI
NLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATP
RSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005058
RefSeq Size 2632
RefSeq ORF 972
Synonyms hSiah2
Locus ID 6478
UniProt ID O43255
Cytogenetics 3q25.1
Summary This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in regulating cellular response to hypoxia. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:SIAH2 (NM_005067) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417551 SIAH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417551 Transient overexpression lysate of seven in absentia homolog 2 (Drosophila) (SIAH2) 100 ug
$436.00
TP303802 Recombinant protein of human seven in absentia homolog 2 (Drosophila) (SIAH2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.