TFAP4 (NM_003223) Human Mass Spec Standard

SKU
PH303773
TFAP4 MS Standard C13 and N15-labeled recombinant protein (NP_003214)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203773]
Predicted MW 38.7 kDa
Protein Sequence
Protein Sequence
>RC203773 protein sequence
Red=Cloning site Green=Tags(s)

MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQS
LKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSP
DIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQVQLQQQQEQVRLLHQE
KLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIE
GTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003214
RefSeq Size 2147
RefSeq ORF 1014
Synonyms AP-4; bHLHc41
Locus ID 7023
UniProt ID Q01664
Cytogenetics 16p13.3
Summary Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]).[supplied by OMIM, Jul 2009]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:TFAP4 (NM_003223) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401113 TFAP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401113 Transient overexpression lysate of transcription factor AP-4 (activating enhancer binding protein 4) (TFAP4) 100 ug
$436.00
TP303773 Recombinant protein of human transcription factor AP-4 (activating enhancer binding protein 4) (TFAP4), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.