OXCT1 (NM_000436) Human Mass Spec Standard

SKU
PH303764
OXCT1 MS Standard C13 and N15-labeled recombinant protein (NP_000427)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203764]
Predicted MW 56.2 kDa
Protein Sequence
Protein Sequence
>RC203764 protein sequence
Red=Cloning site Green=Tags(s)

MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVLVGGFGLCGIP
ENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGT
LAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILEEAITGDFALV
KAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIE
RLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGL
GPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV
KGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELW
EGLTVDDVQKSTGCDFAVSPKLMPMQQIAN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000427
RefSeq Size 3572
RefSeq ORF 1560
Synonyms OXCT; SCOT
Locus ID 5019
UniProt ID P55809
Cytogenetics 5p13.1
Summary This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency. [provided by RefSeq, Jul 2008]
Protein Pathways Butanoate metabolism, leucine and isoleucine degradation, Synthesis and degradation of ketone bodies, Valine
Write Your Own Review
You're reviewing:OXCT1 (NM_000436) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400157 OXCT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400157 Transient overexpression lysate of 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP303764 Recombinant protein of human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.