ERGIC1 (NM_001031711) Human Mass Spec Standard

SKU
PH303612
ERGIC1 MS Standard C13 and N15-labeled recombinant protein (NP_001026881)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203612]
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC203612 protein sequence
Red=Cloning site Green=Tags(s)

MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDDPDKDSGGKID
VSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINKVPGNFHVSTHSATAQ
PQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYT
VANKEYVAYSHTGRIIPAIWFRYDLSPITVKYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEA
WKKIQLGKMH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001026881
RefSeq Size 2949
RefSeq ORF 870
Synonyms AMC2; AMCN; ERGIC-32; ERGIC32; NET24
Locus ID 57222
UniProt ID Q969X5
Cytogenetics 5q35.1
Summary This gene encodes a cycling membrane protein which is an endoplasmic reticulum-golgi intermediate compartment (ERGIC) protein which interacts with other members of this protein family to increase their turnover. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ERGIC1 (NM_001031711) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412466 ERGIC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422162 ERGIC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412466 Transient overexpression lysate of endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1 (ERGIC1), transcript variant 2 100 ug
$436.00
LY422162 Transient overexpression lysate of endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1 (ERGIC1) 100 ug
$436.00
TP303612 Recombinant protein of human endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1 (ERGIC1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.