OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

JUNB (NM_002229) Human Mass Spec Standard

Be the first to review this product
SKU
PH303595
JUNB MS Standard C13 and N15-labeled recombinant protein (NP_002220)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY419421 Transient overexpression lysate of jun B proto-oncogene (JUNB) (as WB positive control) 100 ug
$436.00

Other products for "JUNB or NM_002229"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203595
Predicted MW 35.9 kDa
Protein Sequence
Protein Sequence
>RC203595 protein sequence
Blue=ORF Red=Cloning site Green=Tag(s)

MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGP
EGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG
AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPP
VYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFK
EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV
KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002220
RefSeq Size 1832
RefSeq ORF 1041
Synonyms AP-1
Locus ID 3726
UniProt ID P17275
Cytogenetics 19p13.13
Summary Transcription factor involved in regulating gene activity following the primary growth factor response. Binds to the DNA sequence 5'-TGACGTCA-3'.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "JUNB" proteins (3)
SKU Description Size Price
LC419421 Lyophilized JUNB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419421 Transient overexpression lysate of jun B proto-oncogene (JUNB) (as WB positive control) 100 ug
$436.00
TP303595 Recombinant protein of human jun B proto-oncogene (JUNB), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products