SMCR7L (MIEF1) (NM_019008) Human Mass Spec Standard

SKU
PH303568
SMCR7L MS Standard C13 and N15-labeled recombinant protein (NP_061881)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203568]
Predicted MW 51.3 kDa
Protein Sequence
Protein Sequence
>RC203568 protein sequence
Red=Cloning site Green=Tags(s)

MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRS
WEEPNWMGSPRLLNRDMKTGLSRSLQTLPTDSSTFDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLL
TYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVL
EQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIG
SLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLR
ALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLE
AGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061881
RefSeq Size 5730
RefSeq ORF 1389
Synonyms AltMIEF1; dJ1104E15.3; HSU79252; MID51; MIEF1-MP; SMCR7L
Locus ID 54471
UniProt ID Q9NQG6
Cytogenetics 22q13.1
Summary Mitochondrial outer membrane protein which regulates mitochondrial fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface independently of the mitochondrial fission FIS1 and MFF proteins. Regulates DNM1L GTPase activity and DNM1L oligomerization. Binds ADP and can also bind GDP, although with lower affinity. Does not bind CDP, UDP, ATP, AMP or GTP. Inhibits DNM1L GTPase activity in the absence of bound ADP. Requires ADP to stimulate DNM1L GTPase activity and the assembly of DNM1L into long, oligomeric tubules with a spiral pattern, as opposed to the ring-like DNM1L oligomers observed in the absence of bound ADP. Does not require ADP for its function in recruiting DNM1L.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SMCR7L (MIEF1) (NM_019008) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412846 MIEF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412846 Transient overexpression lysate of Smith-Magenis syndrome chromosome region, candidate 7-like (SMCR7L) 100 ug
$436.00
TP303568 Recombinant protein of human Smith-Magenis syndrome chromosome region, candidate 7-like (SMCR7L), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.