OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRMT5 (NM_006109) Human Mass Spec Standard

Be the first to review this product
SKU
PH303458
PRMT5 MS Standard C13 and N15-labeled recombinant protein (NP_006100)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA807621 PRMT5 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3) 100 ul
$447.00
LY416847 Transient overexpression lysate of protein arginine methyltransferase 5 (PRMT5), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PRMT5 or NM_006109"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203458
Predicted MW 72.7 kDa
Protein Sequence
Protein Sequence
>RC203458 protein sequence
Red=Cloning site Green=Tags(s)

MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSD
LLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTN
HIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGA
DLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSY
LQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVP
EEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM
REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREK
DRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLY
QDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTG
RSYTIGL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006100
RefSeq Size 2541
RefSeq ORF 1911
Synonyms HRMT1L5; HSL7; IBP72; JBP1; SKB1; SKB1Hs
Locus ID 10419
UniProt ID O14744
Cytogenetics 14q11.2
Summary This gene encodes an enzyme that belongs to the methyltransferase family. The encoded protein catalyzes the transfer of methyl groups to the amino acid arginine, in target proteins that include histones, transcriptional elongation factors and the tumor suppressor p53. This gene plays a role in several cellular processes, including transcriptional regulation, and the assembly of small nuclear ribonucleoproteins. A pseudogene of this gene has been defined on chromosome 4. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Sep 2015
Protein Families Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRMT5" proteins (5)
SKU Description Size Price
LC416847 Lyophilized PRMT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422095 Lyophilized PRMT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416847 Transient overexpression lysate of protein arginine methyltransferase 5 (PRMT5), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422095 Transient overexpression lysate of protein arginine methyltransferase 5 (PRMT5), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP303458 Recombinant protein of human protein arginine methyltransferase 5 (PRMT5), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products