UBTD1 (NM_024954) Human Mass Spec Standard

SKU
PH303403
UBTD1 MS Standard C13 and N15-labeled recombinant protein (NP_079230)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203403]
Predicted MW 25.8 kDa
Protein Sequence
Protein Sequence
>RC203403 representing NM_024954
Red=Cloning site Green=Tags(s)

MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDA
LKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPE
PPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQ
KDFVIQVIINQPPPPQD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079230
RefSeq Size 1575
RefSeq ORF 681
Locus ID 80019
UniProt ID Q9HAC8
Cytogenetics 10q24.1-q24.2
Summary The degradation of many proteins is carried out by the ubiquitin pathway in which proteins are targeted for degradation by covalent conjugation of the polypeptide ubiquitin. This gene encodes a protein that belongs to the ubiquitin family of proteins. The encoded protein is thought to regulate E2 ubiquitin conjugating enzymes belonging to the UBE2D family. [provided by RefSeq, Mar 2014]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:UBTD1 (NM_024954) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410953 UBTD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410953 Transient overexpression lysate of ubiquitin domain containing 1 (UBTD1) 100 ug
$436.00
TP303403 Recombinant protein of human ubiquitin domain containing 1 (UBTD1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.