UBTD1 (NM_024954) Human Tagged ORF Clone

SKU
RC203403
UBTD1 (Myc-DDK-tagged)-Human ubiquitin domain containing 1 (UBTD1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UBTD1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203403 representing NM_024954
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAACTGCGTGGGGAGACAGCGCCGGGAGAGGCCGGCAGCCCCGGGACACCCCCGCAAGCGAGCAG
GACGCAATGAGCCCCTGAAGAAAGAGCGGCTTAAGTGGAAGAGCGACTACCCCATGACTGACGGGCAGCT
GCGGAGCAAACGGGATGAGTTCTGGGACACAGCGCCTGCCTTCGAGGGCCGCAAGGAGATCTGGGATGCC
CTCAAGGCTGCCGCCTATGCTGCTGAAGCCAACGACCACGAGCTGGCCCAGGCCATCCTGGATGGAGCCA
GCATCACCCTGCCTCATGGCACCCTCTGTGAATGCTACGATGAGCTGGGCAATCGCTACCAGCTGCCCAT
CTACTGCCTGTCACCGCCGGTGAACCTGCTGCTGGAGCACACGGAGGAGGAGAGCCTGGAGCCCCCCGAG
CCTCCACCCAGCGTGCGCCGTGAGTTCCCGCTGAAGGTGCGCCTGTCCACGGGCAAGGACGTGAGGCTCA
GCGCCAGCCTGCCCGACACAGTGGGGCAGCTCAAGAGGCAGCTGCACGCCCAGGAGGGCATCGAGCCATC
GTGGCAGCGGTGGTTCTTCTCCGGGAAGCTGCTCACAGACCGCACACGGCTCCAGGAGACCAAGATCCAG
AAAGATTTTGTCATCCAGGTCATCATCAACCAGCCCCCACCACCCCAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203403 representing NM_024954
Red=Cloning site Green=Tags(s)

MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDA
LKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPE
PPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQ
KDFVIQVIINQPPPPQD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024954
ORF Size 681 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024954.5
RefSeq Size 1575 bp
RefSeq ORF 684 bp
Locus ID 80019
UniProt ID Q9HAC8
Cytogenetics 10q24.1-q24.2
Domains UBQ
Protein Families Druggable Genome
MW 25.8 kDa
Summary The degradation of many proteins is carried out by the ubiquitin pathway in which proteins are targeted for degradation by covalent conjugation of the polypeptide ubiquitin. This gene encodes a protein that belongs to the ubiquitin family of proteins. The encoded protein is thought to regulate E2 ubiquitin conjugating enzymes belonging to the UBE2D family. [provided by RefSeq, Mar 2014]
Write Your Own Review
You're reviewing:UBTD1 (NM_024954) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203403L3 Lenti ORF clone of Human ubiquitin domain containing 1 (UBTD1), Myc-DDK-tagged 10 ug
$600.00
RC203403L4 Lenti ORF clone of Human ubiquitin domain containing 1 (UBTD1), mGFP tagged 10 ug
$600.00
RG203403 UBTD1 (tGFP-tagged) - Human ubiquitin domain containing 1 (UBTD1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319217 UBTD1 (untagged)-Human ubiquitin domain containing 1 (UBTD1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.