ZFYVE21 (NM_024071) Human Mass Spec Standard

SKU
PH303337
ZFYVE21 MS Standard C13 and N15-labeled recombinant protein (NP_076976)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203337]
Predicted MW 26.5 kDa
Protein Sequence
Protein Sequence
>RC203337 protein sequence
Red=Cloning site Green=Tags(s)

MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECRRCMQCDAKFDFLTRKHHCRRCG
KCFCDRCCSQKVPLRRMCFVDPVRQCAECALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRL
SNNQRYLFLDGDSHYEIEIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGTEGVTQLKLTVVEDVTVG
RRQAVAWLVAMHKAAKLLYESRDQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076976
RefSeq Size 1470
RefSeq ORF 702
Synonyms HCVP7TP1; ZF21
Locus ID 79038
UniProt ID Q9BQ24
Cytogenetics 14q32.33
Summary Plays a role in cell adhesion, and thereby in cell motility which requires repeated formation and disassembly of focal adhesions. Regulates microtubule-induced PTK2/FAK1 dephosphorylation, an event important for focal adhesion disassembly, as well as integrin beta-1/ITGB1 cell surface expression.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ZFYVE21 (NM_024071) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411387 ZFYVE21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411387 Transient overexpression lysate of zinc finger, FYVE domain containing 21 (ZFYVE21) 100 ug
$436.00
TP303337 Recombinant protein of human zinc finger, FYVE domain containing 21 (ZFYVE21), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.