ZFYVE21 (NM_024071) Human Tagged ORF Clone

SKU
RC203337
ZFYVE21 (Myc-DDK-tagged)-Human zinc finger, FYVE domain containing 21 (ZFYVE21), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ZFYVE21
Synonyms HCVP7TP1; ZF21
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203337 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTCCGAGGTGTCCGCGCGCCGCGACGCCAAGAAGCTGGTGCGCTCCCCGAGCGGCCTGCGCATGG
TGCCCGAACACCGCGCCTTCGGAAGCCCGTTCGGCCTGGAGGAGCCGCAGTGGGTCCCGGACAAGGAGTG
TCGGAGATGTATGCAGTGTGACGCCAAGTTTGACTTTCTCACCAGAAAGCACCACTGTCGCCGCTGCGGG
AAGTGCTTCTGCGACAGGTGCTGCAGCCAGAAGGTGCCGCTGCGGCGCATGTGCTTTGTGGACCCCGTGC
GGCAGTGCGCGGAGTGCGCCCTCGTGTCCCTCAAGGAGGCGGAGTTCTACGACAAGCAGCTCAAAGTGCT
CCTGAGCGGAGCCACCTTCCTCGTCACGTTTGGAAACTCAGAGAAACCTGAAACTATGACTTGTCGTCTT
TCCAATAACCAGAGATACTTGTTTCTGGATGGAGACAGCCACTATGAAATCGAAATTGTACACATTTCCA
CCGTGCAGATCCTCACAGAAGGCTTCCCTCCTGGAGGAGGCAACGCACGGGCCACAGGCATGTTCCTGCA
GTATACAGTGCCGGGGACGGAGGGTGTGACCCAGCTGAAGCTGACAGTGGTGGAGGACGTGACTGTGGGC
AGGAGGCAGGCGGTGGCGTGGCTAGTGGCCATGCACAAGGCTGCCAAGCTCCTCTATGAATCTCGGGACC
AG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203337 protein sequence
Red=Cloning site Green=Tags(s)

MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECRRCMQCDAKFDFLTRKHHCRRCG
KCFCDRCCSQKVPLRRMCFVDPVRQCAECALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRL
SNNQRYLFLDGDSHYEIEIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGTEGVTQLKLTVVEDVTVG
RRQAVAWLVAMHKAAKLLYESRDQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024071
ORF Size 702 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024071.4
RefSeq Size 1470 bp
RefSeq ORF 705 bp
Locus ID 79038
UniProt ID Q9BQ24
Cytogenetics 14q32.33
Domains FYVE
MW 26.5 kDa
Summary Plays a role in cell adhesion, and thereby in cell motility which requires repeated formation and disassembly of focal adhesions. Regulates microtubule-induced PTK2/FAK1 dephosphorylation, an event important for focal adhesion disassembly, as well as integrin beta-1/ITGB1 cell surface expression.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ZFYVE21 (NM_024071) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203337L3 Lenti ORF clone of Human zinc finger, FYVE domain containing 21 (ZFYVE21), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC203337L4 Lenti ORF clone of Human zinc finger, FYVE domain containing 21 (ZFYVE21), transcript variant 2, mGFP tagged 10 ug
$600.00
RG203337 ZFYVE21 (tGFP-tagged) - Human zinc finger, FYVE domain containing 21 (ZFYVE21), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC108062 ZFYVE21 (untagged)-Human zinc finger, FYVE domain containing 21 (ZFYVE21), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.